Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0640800_circ_g.2 |
| ID in PlantcircBase | osa_circ_020750 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 24653605-24653793 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0640800 |
| Parent gene annotation |
Class III homeodomain Leu zipper (HD-Zip III) family member, Con trol of plant type architecture and leaf development (Os03t06408 00-01);Similar to cDNA clone:J033124M18, full insert sequence. ( Os03t0640800-02);Similar to cDNA clone:J033124M18, full insert s equence. (Os03t0640800-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0640825-00:1 Os03t0640825-00:1 Os03t0640800-02:1 Os03t0640800-01:1 Os03t0640800-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.446347487 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24653657-24653607(-) |
| Potential amino acid sequence |
MGSQVILPLAHTLEHEENVPPALLVRFLREHRSEWADPGVDAYSAAALRASPYAVPGLRAGGFM GSQVILPLAHTLEHEENVPPALLVRFLREHRSEWADPGVDAYSAAALRASPYAVPGLRAGGFMG SQVILPLAHTLEHEENVPPALLVRFLREHRSEWADPGVDAYSAAALRASPYAVPGLRAGGFMGS QVILPLAHTLEHEE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |