Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0594300_circ_g.2 |
ID in PlantcircBase | osa_circ_012158 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 24949051-24949869 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os12g0594300 |
Parent gene annotation |
Hypothetical conserved gene. (Os12t0594300-00) |
Parent gene strand | + |
Alternative splicing | Os12g0594300_circ_g.1 |
Support reads | 3 |
Tissues | shoot, root, anther |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0594300-00:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.270352381 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24949172-24949130(+) 24949152-24949419(-) |
Potential amino acid sequence |
MVNGSLRNVLLRKDRMLDRRKRLIIAMDAAFGMEYLHSKSIVHFDLKCDNLLVNLRDPQRPICK VGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGIALWEILTGEEPYANM HCGAIIDQRLLEGSTNSFKVASSKCCCFLWGGS*(+) MFLQFHQEPPHRKQQHLDDATLKEFVLPSKSLWSMIAPQCIFAYGSSPVKISHKAIPKENTSTF SDTRLLLPFKSSGAIHGRVPRTPPETKVLRLILDNPKSPTLQIGL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |