Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0594300_circ_g.2 |
| ID in PlantcircBase | osa_circ_012158 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 24949051-24949869 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os12g0594300 |
| Parent gene annotation |
Hypothetical conserved gene. (Os12t0594300-00) |
| Parent gene strand | + |
| Alternative splicing | Os12g0594300_circ_g.1 |
| Support reads | 3 |
| Tissues | shoot, root, anther |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0594300-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.270352381 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24949172-24949130(+) 24949152-24949419(-) |
| Potential amino acid sequence |
MVNGSLRNVLLRKDRMLDRRKRLIIAMDAAFGMEYLHSKSIVHFDLKCDNLLVNLRDPQRPICK VGDFGLSRIKRNTLVSGGVRGTLPWMAPELLNGSSSRVSEKVDVFSFGIALWEILTGEEPYANM HCGAIIDQRLLEGSTNSFKVASSKCCCFLWGGS*(+) MFLQFHQEPPHRKQQHLDDATLKEFVLPSKSLWSMIAPQCIFAYGSSPVKISHKAIPKENTSTF SDTRLLLPFKSSGAIHGRVPRTPPETKVLRLILDNPKSPTLQIGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |