Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G115200_circ_g.2 |
| ID in PlantcircBase | gra_circ_000841 |
| Alias | Chr08:34780935|34783382 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 34780935-34783382 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G115200 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.008G115200_circ_g.1 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.008G115200.1:5 Gorai.008G115200.2:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000311* |
| PMCS | 0.451856669 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34783366-34783361(-) 34782313-34780963(+) |
| Potential amino acid sequence |
MVRGKTQMRRIENDTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLFEFASSSMQQ TVERYRRHTKDNETNKPIEQNLQHLKTESANMLKALEDLEVSRRKLLGENLGSCTLEELQEIEQ QLEKSVSIIRARKTQIFRDQIEQLKEKVRRSSSW*(-) MLELANSKSLPLGEKMIKATSASQRTDSSKAFFSSPFRRFENVTCLLVSFSMRLICVFPLTMMR IFVPFLSIVQSGP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |