Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G256800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000678 |
| Alias | Chr06:49877239|49877449 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 49877239-49877449 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G256800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G256800.2:1 Gorai.006G256800.1:1 Gorai.006G256800.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.453001975 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
49877427-49877412(-) 49877384-49877238(+) |
| Potential amino acid sequence |
MADVVDAAGEPIPTSSVLMAAAKHIEINCMSENVEFLKCKKKDPNPEKCLDKGRQATRCALGLK KRSFFGNGGRG*(-) MSGSVHPPHQPRPPFPKKDRFFSPRAQRVAWRPLSRHFSGFGSFFLHLRNSTFSDMQLISMCLA AAIRTDDVGIGSPAASTTSAISEERSLL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |