Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0558850_circ_g.2 |
ID in PlantcircBase | osa_circ_002193 |
Alias | Os01circ14692/Os_ciR5829 |
Organism | Oryza sativa |
Position | chr1: 21160403-21160540 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup, find_circ |
Parent gene | Os01g0558850 |
Parent gene annotation |
Similar to peptidase M16 family protein / insulinase family prot ein. (Os01t0558850-00) |
Parent gene strand | + |
Alternative splicing | Os01g0558850_circ_g.1 Os01g0558850_circ_g.3 Os01g0558850_circ_g.4 |
Support reads | 5/2/3/2 |
Tissues | leaf/root/root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0558850-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.568120229 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21160416-21160537(+) 21160495-21160415(+) 21160456-21160469(-) |
Potential amino acid sequence |
MIKEHFGQKAPPSCPPPVIPDFPVPSHVEPRFSCFVESEAAGAVVEMIKEHFGQKAPPSCPPPV IPDFPVPSHVEPRFSCFVESEAAGAVVEMIKEHFGQKAPPSCPPPVIPDFPVPSHVEPRFSCFV ESEAAGAVVEMIKEHFGQKAPPSCPPPVIPDFPVPSHVEPRFSCFVESEAAG(+) MLNLGFHALWNLKLQGLLLK*(+) MKVGLSGQSAPLSFQQQPLQLQIPQSMKTEVQHAMVLENLV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |