Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0558850_circ_g.2 |
| ID in PlantcircBase | osa_circ_002193 |
| Alias | Os01circ14692/Os_ciR5829 |
| Organism | Oryza sativa |
| Position | chr1: 21160403-21160540 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup, find_circ |
| Parent gene | Os01g0558850 |
| Parent gene annotation |
Similar to peptidase M16 family protein / insulinase family prot ein. (Os01t0558850-00) |
| Parent gene strand | + |
| Alternative splicing | Os01g0558850_circ_g.1 Os01g0558850_circ_g.3 Os01g0558850_circ_g.4 |
| Support reads | 5/2/3/2 |
| Tissues | leaf/root/root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0558850-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.568120229 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21160416-21160537(+) 21160495-21160415(+) 21160456-21160469(-) |
| Potential amino acid sequence |
MIKEHFGQKAPPSCPPPVIPDFPVPSHVEPRFSCFVESEAAGAVVEMIKEHFGQKAPPSCPPPV IPDFPVPSHVEPRFSCFVESEAAGAVVEMIKEHFGQKAPPSCPPPVIPDFPVPSHVEPRFSCFV ESEAAGAVVEMIKEHFGQKAPPSCPPPVIPDFPVPSHVEPRFSCFVESEAAG(+) MLNLGFHALWNLKLQGLLLK*(+) MKVGLSGQSAPLSFQQQPLQLQIPQSMKTEVQHAMVLENLV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |