Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G269600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000103 |
| Alias | Chr01:54623047|54623824 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 54623047-54623824 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G269600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 19 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.001G269600.3:3 Gorai.001G269600.4:5 Gorai.001G269600.1:5 Gorai.001G269600.2:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.135512382 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
54623643-54623785(-) 54623786-54623076(+) |
| Potential amino acid sequence |
MVTNPIDYVEPLGKAGASGFTFHVEVSKENWQELIQKIKLKGMRPGVALKPGTPIEEVYPLINS ENPVEMVLVMTVEPGFGGQKFMPEMMEKVRMLRNKYPSLDIEALRSEPNHWCSGH*(-) MTGAPMVRFGTKCLYIERWILVP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |