Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G34540_circ_g.3 |
ID in PlantcircBase | ath_circ_034661 |
Alias | AT4G34540_C1, AT4G34540_C1 |
Organism | Arabidpsis thaliana |
Position | chr4: 16500819-16501369 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT4G34540 |
Parent gene annotation |
Probable pinoresinol-lariciresinol reductase 3 |
Parent gene strand | + |
Alternative splicing | AT4G34540_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G34540.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.593940311 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16501229-16500832(+) 16501356-16500832(+) |
Potential amino acid sequence |
MIESEGIPYTYICCGLFMRVLLPSLVQPGLQSPPTDKVTVFGDGNVKGFIGG* METLKGSLEDEGSLAEAVSKVDVVISAIPSKHVLDQKLLVRVIKQAGSIKRFIPAEYGANPDKT QVSDLDHDFYSKKSEIRHMIESEGIPYTYICCGLFMRVLLPSLVQPGLQSPPTDKVTVFGDGNV KGFIGG* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |