Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G34540_circ_g.3 |
| ID in PlantcircBase | ath_circ_034661 |
| Alias | AT4G34540_C1, AT4G34540_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16500819-16501369 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT4G34540 |
| Parent gene annotation |
Probable pinoresinol-lariciresinol reductase 3 |
| Parent gene strand | + |
| Alternative splicing | AT4G34540_circ_g.4 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G34540.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.593940311 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16501229-16500832(+) 16501356-16500832(+) |
| Potential amino acid sequence |
MIESEGIPYTYICCGLFMRVLLPSLVQPGLQSPPTDKVTVFGDGNVKGFIGG* METLKGSLEDEGSLAEAVSKVDVVISAIPSKHVLDQKLLVRVIKQAGSIKRFIPAEYGANPDKT QVSDLDHDFYSKKSEIRHMIESEGIPYTYICCGLFMRVLLPSLVQPGLQSPPTDKVTVFGDGNV KGFIGG* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |