Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0731900_circ_g.1 |
| ID in PlantcircBase | osa_circ_032534 |
| Alias | Os_ciR10675 |
| Organism | Oryza sativa |
| Position | chr6: 31212758-31213210 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0731900 |
| Parent gene annotation |
Protein of unknown function DUF707 family protein. (Os06t0731900 -01);Similar to Lysine ketoglutarate reductase trans-splicing re lated 1. (Os06t0731900-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0731900-02:2 Os06t0731900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168588337 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31212870-31213207(+) |
| Potential amino acid sequence |
MYLRPLWDSGANPKNKNDNHNALLAMAVGISQMQNVDIMARKEDRLTGDRTFATTTTDPVHWRT GAEGLPRGIVHSNSDMYLRPLWDSGANPKNKNDNHNALLAMAVGISQMQNVDIMARKEDRLTGD RTFATTTTDPVHWRTGAEGLPRGIVHSNSDMYLRPLWDSGANPKNKNDNHNALLAMAVGISQMQ NVDIMARKEDRLTGDRTFATTTTDPVHWRTGAEGLPRGIVHSNSDMYLRPLWDSGANPKNKNDN HNALLAMAVGISQMQNVDIMARK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |