Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G03650_circ_g.9 |
| ID in PlantcircBase | ath_circ_036206 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 933479-933538 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT5G03650 |
| Parent gene annotation |
1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplasti c |
| Parent gene strand | + |
| Alternative splicing | AT5G03650_circ_g.1 AT5G03650_circ_g.2 AT5G03650_circ_g.3 AT5G03650_circ_g.4 AT5G03650_circ_g.5 AT5G03650_circ_g.6 AT5G03650_circ_g.7 AT5G03650_circ_g.8 AT5G03650_circ_g.10 |
| Support reads | 2 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G03650.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.159724167 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
933530-933535(+) 933532-933481(-) |
| Potential amino acid sequence |
MTRAASLIGDFNNWNSNADIMTRAASLIGDFNNWNSNADIMTRAASLIGDFNNWNSNADIMTR( +) MISALEFQLLKSPISDAARVMISALEFQLLKSPISDAARVMISALEFQLLKSPISDAARVMISA LEFQLLKSPISDA(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |