Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc09g090510.2_circ_g.6 |
| ID in PlantcircBase | sly_circ_002976 |
| Alias | 9:65366869|65367336 |
| Organism | Solanum lycopersicum |
| Position | chr9: 70019000-70019467 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc09g090510.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | Solyc09g090510.2_circ_g.3 Solyc09g090510.2_circ_g.4 Solyc09g090510.2_circ_g.5 |
| Support reads | 10 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc09g090510.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.200887874 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
70019466-70019465(+) 70019054-70019460(-) 70019163-70019428(-) |
| Potential amino acid sequence |
MSEDEDLKVAQERKISLLIKKAKVKKEHHILEIGCGWGSLAVEVVKRTGCKYTGITLSEQQLKY AKLRVQQAGLQDHITFLLCDYRQLPKMSRYDRIIS*(+) MRREIFLSCATFRSSSSLMI*(-) MFLLYLCLFDEKRNFPLLCNFQVFVFTHDIILSYLDIFGN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |