Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0639200_circ_g.2 |
ID in PlantcircBase | osa_circ_020737 |
Alias | Os_ciR8695 |
Organism | Oryza sativa |
Position | chr3: 24521180-24522348 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os03g0639200 |
Parent gene annotation |
Similar to DIRP family protein, expressed. (Os03t0639200-01) |
Parent gene strand | + |
Alternative splicing | Os03g0639200_circ_g.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0639200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.333916068 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24521199-24522345(+) |
Potential amino acid sequence |
MLGSQWSKDELERFYGSYRKYGKDWRKVASSIRDRTSEMVEALYNMNKAYLSLPEGTATAAGLI AMMTDHYNILKKKLSDMLGSQWSKDELERFYGSYRKYGKDWRKVASSIRDRTSEMVEALYNMNK AYLSLPEGTATAAGLIAMMTDHYNILKKKLSDMLGSQWSKDELERFYGSYRKYGKDWRKVASSI RDRTSEMVEALYNMNKAYLSLPEGTATAAGLIAMMTDHYNILKKKLSDMLGSQWSKDELERFYG SYRKYGKDWRKVASSIRDRTSEMVEALYNMNKAYLSLPEGTATAAGLIAMMTDHYNIL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |