Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0544900_circ_g.1 |
ID in PlantcircBase | osa_circ_040106 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 21538388-21538561 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0544900 |
Parent gene annotation |
MaoC-like dehydratase domain containing protein. (Os09t0544900-0 1) |
Parent gene strand | - |
Alternative splicing | Os09g0544900_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0544900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.1570909 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21538461-21538432(+) 21538439-21538416(+) 21538409-21538390(-) |
Potential amino acid sequence |
MLFTAVGSPLQKDLMTARIANPRELRPCSIGRVNLWPWSHISVTKVSPG*(+) MQKKTAKDAFHCCWISIAERFDDSADRESKGTETMQYWTSEPLALEPHFSD*(+) MWLQGQRFTRPILHGLSSLGFAIRAVIKSFCNGDPTAVKSIFGRFLLHVYPGETLVTEMWLQGQ RFTRPILHGLSSLGFAIRAVIKSFCNGDPTAVKSIFGRFLLHVYPGETLVTEMWLQGQRFTRPI LHGLSSLGFAIRAVIKSFCNGDPTAVKSIFGRFLLHVYPGETLVTEMWLQGQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |