Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0544900_circ_g.1 |
| ID in PlantcircBase | osa_circ_040106 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 21538388-21538561 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0544900 |
| Parent gene annotation |
MaoC-like dehydratase domain containing protein. (Os09t0544900-0 1) |
| Parent gene strand | - |
| Alternative splicing | Os09g0544900_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0544900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1570909 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21538461-21538432(+) 21538439-21538416(+) 21538409-21538390(-) |
| Potential amino acid sequence |
MLFTAVGSPLQKDLMTARIANPRELRPCSIGRVNLWPWSHISVTKVSPG*(+) MQKKTAKDAFHCCWISIAERFDDSADRESKGTETMQYWTSEPLALEPHFSD*(+) MWLQGQRFTRPILHGLSSLGFAIRAVIKSFCNGDPTAVKSIFGRFLLHVYPGETLVTEMWLQGQ RFTRPILHGLSSLGFAIRAVIKSFCNGDPTAVKSIFGRFLLHVYPGETLVTEMWLQGQRFTRPI LHGLSSLGFAIRAVIKSFCNGDPTAVKSIFGRFLLHVYPGETLVTEMWLQGQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |