Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0345700_circ_g.10 |
| ID in PlantcircBase | osa_circ_036817 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 15661953-15662646 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os08g0345700 |
| Parent gene annotation |
Similar to Fructose-6-phosphate 1-phosphotransferase (Fragment). (Os08t0345700-01);Similar to Fructose-6-phosphate 1-phosphotran sferase (Fragment). (Os08t0345700-02) |
| Parent gene strand | + |
| Alternative splicing | Os08g0345700_circ_g.9 Os08g0345700_circ_g.11 Os08g0345700_circ_g.12 Os08g0345700_circ_g.13 |
| Support reads | 48 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0345700-02:3 Os08t0345700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.197449616 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15662156-15662155(+) 15662644-15662038(+) |
| Potential amino acid sequence |
MIAAGLTGYMATVANLKDPVDKWRCAAAPLTAMMSVKRHLRGPGAIPIGKPAIHPSPIDLKGKA YEKKEDTREGSSALYAISLDIRLEDPSHQTLTVTMLMLLAVSPCI*(+) MKRRKIQGKEVQLCMPFLWISGSRIRPIKL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |