Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0580300_circ_g.1 |
| ID in PlantcircBase | osa_circ_012113 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 24032511-24034740 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0580300 |
| Parent gene annotation |
Similar to TATA-binding protein TBP2. (Os12t0580300-01) |
| Parent gene strand | + |
| Alternative splicing | Os12g0580300_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0580300-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013383 |
| PMCS | 0.137422104 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24033203-24032588(+) 24033205-24034713(-) |
| Potential amino acid sequence |
MRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYARIIQKLGFAAKFKDFKIQNIVGSCDVK FPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQPKIVLLIFVSGKIVLTGAKKHRVDGQFGLQIR PQSYSFASTQCRI*(+) MITAAKRFGLYSALRACKAIALRSNLQSKLTVDTMFLCSGQNNLA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |