Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0304400_circ_g.3 |
| ID in PlantcircBase | osa_circ_027334 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 13719219-13719320 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0304400 |
| Parent gene annotation |
Similar to GDP dissociation inhibitor protein OsGDI2. (Os05t0304 400-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0304400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.634046569 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13719232-13719317(+) |
| Potential amino acid sequence |
MEGKVCGVTSEGETAKCKKVVCDPSYLPNKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNK VEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVEFDMEGKVCGVTSEGETAKCKKVVCDPSY LPNK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |