Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0590500_circ_g.2 |
ID in PlantcircBase | osa_circ_012146 |
Alias | Os_ciR2844 |
Organism | Oryza sativa |
Position | chr12: 24712272-24712507 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os12g0590500 |
Parent gene annotation |
Similar to Kinesin motor domain containing protein, expressed. ( Os12t0590500-00) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0590500-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009899 |
PMCS | 0.422968679 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24712473-24712470(-) |
Potential amino acid sequence |
MTLKFREDKIHQMEALVRDKLPAESYLLEENNTLLKEIDLLRAKIDKNPEVTRFALENIRLSNK LKRFMRERMIQGVLR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |