Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0590500_circ_g.2 |
| ID in PlantcircBase | osa_circ_012146 |
| Alias | Os_ciR2844 |
| Organism | Oryza sativa |
| Position | chr12: 24712272-24712507 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os12g0590500 |
| Parent gene annotation |
Similar to Kinesin motor domain containing protein, expressed. ( Os12t0590500-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0590500-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009899 |
| PMCS | 0.422968679 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24712473-24712470(-) |
| Potential amino acid sequence |
MTLKFREDKIHQMEALVRDKLPAESYLLEENNTLLKEIDLLRAKIDKNPEVTRFALENIRLSNK LKRFMRERMIQGVLR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |