Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0165000_circ_g.8 |
| ID in PlantcircBase | osa_circ_010576 |
| Alias | Os_ciR3323 |
| Organism | Oryza sativa |
| Position | chr12: 3314012-3315647 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os12g0165000 |
| Parent gene annotation |
WD40 repeat-like domain containing protein. (Os12t0165000-01);Si milar to predicted protein. (Os12t0165000-02) |
| Parent gene strand | - |
| Alternative splicing | Os12g0165000_circ_g.3 Os12g0165000_circ_g.4 Os12g0165000_circ_g.5 Os12g0165000_circ_g.6 Os12g0165000_circ_g.7 Os12g0165000_circ_g.9 Os12g0165000_circ_g.10 |
| Support reads | 3/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0165000-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003303* osi_circ_010116 zma_circ_007664 |
| PMCS | 0.366938809 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3315613-3314302(+) 3315607-3315643(-) |
| Potential amino acid sequence |
MPNLSKTGAAYSLPVGSRSKALILSVCPLNFIFFEPVLGSQTRTTFSVPPETSVFPVSLMANA* (+) MHRVGSAGNTAGSSRPRKEKRFTYVLNDADNKKHCAGINCLSYLNASTSGTSDYLFTGSRDGTL KRWEPKNGVASFSATFESHVDWVNDAIIVGQNLVSCSSDTTLKVWNCLSDGACTRTLRQHSDYV ICLAASEKNSNIVASGGLGGEVFIWDLDSSLAPVAKSVDAKEDEAPNGNSGPALTTLCNVNSSS NLASTNGQSHGYSPITAKGHKDSVYALAMSDTGNTLVSGGTEKVVRVWDPRTGSKKMKLRGHTD NIRALLLDPTGRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |