Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G49680_circ_g.6 |
ID in PlantcircBase | ath_circ_026753 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 18424955-18425050 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G49680 |
Parent gene annotation |
Branched-chain-amino-acid aminotransferase 3, chloroplastic |
Parent gene strand | + |
Alternative splicing | AT3G49680_circ_g.3 AT3G49680_circ_g.4 AT3G49680_circ_g.5 AT3G49680_circ_g.7 |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G49680.1:1 AT3G49680.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.173609462 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18425018-18425047(+) |
Potential amino acid sequence |
MIDVARTQGFQDNVISTPEIKGTILPGITRKSMIDVARTQGFQDNVISTPEIKGTILPGITRKS MIDVARTQGFQDNVISTPEIKGTILPGITRKSMIDVARTQGFQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |