Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0609900_circ_g.2 |
| ID in PlantcircBase | osa_circ_002568 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 24108424-24108651 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0609900 |
| Parent gene annotation |
Similar to Pleiotropic drug resistance protein 4. (Os01t0609900- 01);Similar to PDR-like ABC transporter (PDR4 ABC transporter). (Os01t0609900-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0609900-01:1 Os01t0609900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.515415095 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24108563-24108501(+) 24108463-24108426(-) |
| Potential amino acid sequence |
MNDLEYCVGKLRSVEPGGGVLSSSISSLFLVLVPRFQNIVPNIRAMTIVKSNLTAV*(+) MFGTMFWNLGTRTRNKELIEELSTPPPGSTDLNFPTQYSRSFITQCLACLWKQNWSYWRNPSYT AVRLLFTIVIALMFGTMFWNLGTRTRNKELIEELSTPPPGSTDLNFPTQYSRSFITQCLACLWK QNWSYWRNPSYTAVRLLFTIVIALMFGTMFWNLGTRTRNKELIEELSTPPPGSTDLNFPTQYSR SFITQCLACLWKQNWSYWRNPSYTAVRLLFTIVIALMFGTMFWNLGTR(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |