Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G860260_circ_g.1 |
| ID in PlantcircBase | csa_circ_002154 |
| Alias | Chr3:36031603_36034214 |
| Organism | Cucumis sativus |
| Position | chrChr3: 36031603-36034214 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | Csa3G860260 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | Csa3G860260_circ_g.2 Csa3G860260_circ_g.3 |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa3G860260.1:8 Csa3G860260.2:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.110409214 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
36031610-36034124(-) |
| Potential amino acid sequence |
MLAIWGRCKDQLFALLFVRSKQGFVLCQSIVL* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhu et al., 2019 |