Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0245400_circ_g.2 |
ID in PlantcircBase | osa_circ_036495 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 8882004-8883087 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0245400 |
Parent gene annotation |
Pyridoxal phosphate-dependent transferase, major region, subdoma in 1 domain containing protein. (Os08t0245400-01) |
Parent gene strand | - |
Alternative splicing | Os08g0245400_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0245400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007629* |
PMCS | 0.128541036 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8882523-8882005(+) 8883044-8882045(+) 8882988-8883075(-) |
Potential amino acid sequence |
MTGIFRFLHSLTSNLWKRGSIKCIPPAPCITGSIINAAICSELFDIAYCDSCCDMYETYTLAAD DVSLVLQKTSVNEEKP*(+) MCPWSCKKLQLMRKNLRVTSEGFKNRLCS*(+) MSNNSEHIAALIIEPVIQGAGGMHLIDPLFQRLLVKECKNRKIPVIFDEVFTGFWRLGVESASE LLGCFPDISCYAKLMTGGIVPLAATLATEPIFEAFRSDSKVFPH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |