Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc09g009510.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_002785 |
| Alias | 9:2927204|2927466 |
| Organism | Solanum lycopersicum |
| Position | chr9: 2927204-2927466 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI, circseq_cup |
| Parent gene | Solyc09g009510.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc09g009510.2_circ_g.1 |
| Support reads | 15 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc09g009510.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.844696813 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2927330-2927411(-) 2927466-2927463(-) |
| Potential amino acid sequence |
MGDIWHIKKMVFLETKQNTNLFSSMALIVSDMMLLCSQLLLLNDEKYDSPFWNSDIGTDL*(-) MMRNMIALFGIVILALIYRAIMPPPPKICGSSNGPLITAPRVKLSDGRYLAYKENGVPRDQAKH KFVFIHGFDCVRHDVALLTTTSPE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |