Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0769900_circ_g.3 |
| ID in PlantcircBase | osa_circ_004074 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 32472741-32474400 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os01g0769900 |
| Parent gene annotation |
Similar to PTAC12 (PLASTID TRANSCRIPTIONALLY ACTIVE12). (Os01t07 69900-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0769900_circ_g.4 Os01g0769900_circ_g.5 |
| Support reads | 9 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0769900-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_001486 |
| PMCS | 0.141483519 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32472896-32472803(+) 32472789-32474333(-) |
| Potential amino acid sequence |
MFQHQTAGEFRIMMGTDVRIQRDPLAMRMREDQIKQIWGGDPVYPTINYVHDPDEVADYRGPEF HEPTPEVVPYLMEHGIMITKEELYARLNEEMEDINQDITYLPEVRDPMATAVDIGEHSYNEDSD DDEEDADKVVAQPESLEVRSRTKETRRNRANSILFGMG*(+) MLLALFLLVSFVLLLTSSDSGCATTLSASSSSSSLSSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |