Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0242300_circ_g.1 |
ID in PlantcircBase | osa_circ_001019 |
Alias | Os_ciR6603 |
Organism | Oryza sativa |
Position | chr1: 7853770-7854150 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0242300 |
Parent gene annotation |
Optic atrophy 3 family protein. (Os01t0242300-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0242300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_001933* |
PMCS | 0.410570472 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7854102-7853842(+) 7853819-7854111(-) 7853809-7853810(-) |
Potential amino acid sequence |
MQGQRLGRRKLVNRNLRLTIVLLQGYKGAFMGMQQMWKSHL*(+) MPINAPLYPCSNTMVNLKFLFTSFLLPSL*(-) MRLCILVVTRWLISSSCLRASSFLASDLAFLCTSKIKAATATEKIKPSPMRSVAACTAFSSFKG VISTSVACP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |