Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | orai.009G042700_circ_g.1 |
ID in PlantcircBase | gra_circ_000922 |
Alias | Chr09:3111090|3112076 |
Organism | Gossypium raimondii |
Position | chrChr09: 3111090-3112076 JBrowse» |
Reference genome | Graimondii_221 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Gorai.009G042700 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 6/16 |
Tissues | leaf/ovule |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Gorai.009G042700.4:4 Gorai.009G042700.5:3 Gorai.009G042700.2:4 Gorai.009G042700.1:4 Gorai.009G042700.3:4 |
Conservation Information | |
---|---|
Conserved circRNAs | gar_circ_000069* ghi_circ_000060* |
PMCS | 0.501324493 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3111816-3112044(-) 3111120-3112044(-) |
Potential amino acid sequence |
MEAAFKPEVNGELDTQNFMKFDELDAPAPARTSSGPSRKMLLTPKDLNFVGYTYKNFDAVKGLR HTFDRALEKSPKIS*(-) MRSKGYAILLIVHWKSHLRFPEDSRISHEAKDLICRLLCDVDHRLGTGGAHQIKAHPWFNDVVW DKLYEMEAAFKPEVNGELDTQNFMKFDELDAPAPARTSSGPSRKMLLTPKDLNFVGYTYKNFDA VKGLRHTFDRALEKSPKIS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017b |