Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0721600_circ_g.6 |
| ID in PlantcircBase | osa_circ_016327 |
| Alias | Os_ciR8051 |
| Organism | Oryza sativa |
| Position | chr2: 29939877-29940044 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0721600 |
| Parent gene annotation |
WD40 subfamily protein, Salt stress (Os02t0721600-01);Similar to WD-repeat protein-like. (Os02t0721600-02);Similar to WD-repeat protein-like. (Os02t0721600-03);Similar to WD-repeat protein-lik e. (Os02t0721600-04);Similar to WD-repeat protein-like. (Os02t07 21600-05) |
| Parent gene strand | - |
| Alternative splicing | Os02g0721600_circ_g.1 Os02g0721600_circ_g.2 Os02g0721600_circ_g.3 Os02g0721600_circ_g.4 Os02g0721600_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0721600-01:1 Os02t0721600-05:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.420293651 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29939979-29939899(+) 29939908-29939879(-) 29939916-29939968(-) |
| Potential amino acid sequence |
MVFLEYPFLFLHQLMRYLGSYHSLRLLLQN*(+) MPNSGEAAAKNDKIPDTSSVDARKGKDIQGIPWEKLAITRDKYRQTRLDQYKNYENMPNSGEAA AKNDKIPDTSSVDARKGKDIQGIPWEKLAITRDKYRQTRLDQYKNYENMPNSGEAAAKNDKIPD TSSVDARKGKDIQGIPWEKLAITRDKYRQTRLDQYKNYENMPNSGEAAAK(-) MRTCLILEKQPQRMIRSQIPHQLMQEKERIFKEYHGRS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |