Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G29160_circ_g.3 |
ID in PlantcircBase | ath_circ_033482 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 14381341-14381604 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G29160 |
Parent gene annotation |
Vacuolar protein sorting-associated protein 32 homolog 2 |
Parent gene strand | + |
Alternative splicing | AT4G29160_circ_g.1 AT4G29160_circ_g.2 AT4G29160_circ_g.4 AT4G29160_circ_g.5 AT4G29160_circ_g.6 AT4G29160_circ_g.7 AT4G29160_circ_g.8 AT4G29160_circ_g.9 |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G29160.3:2 AT4G29160.2:2 AT4G29160.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.243428536 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14381350-14381601(+) |
Potential amino acid sequence |
MLEKKEKVLLKKAGAEVEKAKEYSRAKNKRAAIQCLKRKRLYEGQVEQLGNFQLRIHDQTLEML EKKEKVLLKKAGAEVEKAKEYSRAKNKRAAIQCLKRKRLYEGQVEQLGNFQLRIHDQTLEMLEK KEKVLLKKAGAEVEKAKEYSRAKNKRAAIQCLKRKRLYEGQVEQLGNFQLRIHDQTLEMLEKKE KVLLKKAGAEVEKAKEYSRAKNKRAAIQCLKRKRLYEGQVEQLGNFQLRIHDQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |