Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0497700_circ_g.4 |
| ID in PlantcircBase | osa_circ_014717 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 17513094-17513376 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0497700 |
| Parent gene annotation |
Similar to Ras-GTPase-activating protein SH3-domain binding prot ein-like. (Os02t0497700-01);Similar to Ras-GTPase-activating pro tein SH3-domain binding protein-like. (Os02t0497700-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0497700_circ_g.1 Os02g0497700_circ_g.2 Os02g0497700_circ_g.3 Os02g0497700_circ_g.5 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0497700-01:2 Os02t0497700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.211205771 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17513367-17513142(+) 17513290-17513098(+) 17513342-17513338(+) |
| Potential amino acid sequence |
MCINSIALWTAVASSNSTKP*(+) MVPNFLNSSSSCVVVAFNGRLLTYIACASTL*(+) MVDSSRISHVHQLYSTLDCSSFLEFNKAITEPLNLMASDLNPIRFYGAKLLELILQLCRSGI*( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |