Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0143400_circ_g.1 |
ID in PlantcircBase | osa_circ_010459 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 2133176-2134091 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, circseq_cup |
Parent gene | Os12g0143400 |
Parent gene annotation |
Similar to RED family protein. (Os12t0143400-00) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 4/3 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0143400-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.152423481 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2133208-2133957(-) |
Potential amino acid sequence |
MQRMGRIHRQERRKRKNQRHLGIEIVLRSAVKIKTLTMNLQSLVHFMLWHLPEQI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2016;Chu et al., 2017 |