Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0181800_circ_g.2 |
| ID in PlantcircBase | osa_circ_018220 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 4289976-4290657 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0181800 |
| Parent gene annotation |
Protein of unknown function DUF936, plant family protein. (Os03t 0181800-01);Hypothetical conserved gene. (Os03t0181800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0181800-01:2 Os03t0181800-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013956 |
| PMCS | 0.272445393 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4290106-4290012(+) |
| Potential amino acid sequence |
MSKDSKKESASEKNSPPKLYKTSPPTPTPTPPPPAMTSPPKLNLAAKPNGTSGTVTSTPTVKRR VTETVSWDSLPTSLIKSVKVVARRKTIALVVAAEAQREATAAASLLKGLGNGQILHLAVLLR*( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |