Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0181800_circ_g.2 |
ID in PlantcircBase | osa_circ_018220 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 4289976-4290657 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0181800 |
Parent gene annotation |
Protein of unknown function DUF936, plant family protein. (Os03t 0181800-01);Hypothetical conserved gene. (Os03t0181800-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0181800-01:2 Os03t0181800-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013956 |
PMCS | 0.272445393 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4290106-4290012(+) |
Potential amino acid sequence |
MSKDSKKESASEKNSPPKLYKTSPPTPTPTPPPPAMTSPPKLNLAAKPNGTSGTVTSTPTVKRR VTETVSWDSLPTSLIKSVKVVARRKTIALVVAAEAQREATAAASLLKGLGNGQILHLAVLLR*( +) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |