Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G36940_circ_g.5 |
ID in PlantcircBase | ath_circ_041278 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 14591523-14591663 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT5G36940 |
Parent gene annotation |
Cationic amino acid transporter 3, mitochondrial |
Parent gene strand | + |
Alternative splicing | AT5G36940_circ_g.2 AT5G36940_circ_g.3 AT5G36940_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G36940.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.261477983 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14591526-14591660(+) |
Potential amino acid sequence |
MIFGGEDCLPTILARHQIPGLDIVVDPCAAVLVFIVTGLCCLGVKEAMIFGGEDCLPTILARHQ IPGLDIVVDPCAAVLVFIVTGLCCLGVKEAMIFGGEDCLPTILARHQIPGLDIVVDPCAAVLVF IVTGLCCLGVKEAMIFGGEDCLPTILARHQIPGLDIVVDPCAAVLVFIVTGLCCLGVKE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |