Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G21540_circ_g.5 |
| ID in PlantcircBase | ath_circ_014246 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 9222917-9223183 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT2G21540 |
| Parent gene annotation |
Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 |
| Parent gene strand | - |
| Alternative splicing | AT2G21540_circ_g.4 |
| Support reads | 28 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G21540.5:1 AT2G21540.1:1 AT2G21540.6:1 AT2G21540.2:1 AT2G21540.4:1 AT2G21540.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.506795663 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9223061-9222919(-) |
| Potential amino acid sequence |
MQVTTIDRYVKYHVREFEKTFNIKLPACSIAAKKHIDQSTTILDVQGVDFDFKEIDEVLKYYPQ GYHGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFEKTFNIKLPACSIAAKKHIDQS TTILDVQGVDFDFKEIDEVLKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHV REFEKTFNIKLPACSIAAKKHIDQSTTILDVQGVDFDFKEIDEVLKYYPQGYHGVDKDGRPVYI ERLGQVDATKLMQVTTIDRYVKYHVREFEKTFNIKLPACSIAAKKHIDQSTTILDVQGV(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |