Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G21540_circ_g.5 |
ID in PlantcircBase | ath_circ_014246 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 9222917-9223183 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | AT2G21540 |
Parent gene annotation |
Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 |
Parent gene strand | - |
Alternative splicing | AT2G21540_circ_g.4 |
Support reads | 28 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G21540.5:1 AT2G21540.1:1 AT2G21540.6:1 AT2G21540.2:1 AT2G21540.4:1 AT2G21540.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.506795663 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9223061-9222919(-) |
Potential amino acid sequence |
MQVTTIDRYVKYHVREFEKTFNIKLPACSIAAKKHIDQSTTILDVQGVDFDFKEIDEVLKYYPQ GYHGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFEKTFNIKLPACSIAAKKHIDQS TTILDVQGVDFDFKEIDEVLKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHV REFEKTFNIKLPACSIAAKKHIDQSTTILDVQGVDFDFKEIDEVLKYYPQGYHGVDKDGRPVYI ERLGQVDATKLMQVTTIDRYVKYHVREFEKTFNIKLPACSIAAKKHIDQSTTILDVQGV(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |