Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G185500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000296 |
| Alias | Chr03:45624411|45625405 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 45624411-45625405 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G185500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-No |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.003G185500.2:2 Gorai.003G185500.1:2 Gorai.003G185500.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.102611608 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
45625310-45625372(-) |
| Potential amino acid sequence |
MYGAFEDIVLLGHRLIQSLCVCIFSLFRHFTSNSNFGRADFWCHRQSSPMKRHDSFFSNFFFYL LPDVEIIIRF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |