Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0106700_circ_g.3 |
| ID in PlantcircBase | osa_circ_043341 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 306742-306966 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os11g0106700 |
| Parent gene annotation |
Similar to Ferritin 1, chloroplast precursor (EC 1.16.3.1) (ZmFe r1). (Os11t0106700-01);Similar to Ferritin 1, chloroplast precur sor (EC 1.16.3.1) (ZmFer1). (Os11t0106700-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0106700_circ_g.1 Os11g0106700_circ_g.2 Os11g0106700_circ_g.4 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0106700-02:2 Os11t0106700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.200742593 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
306957-306918(-) |
| Potential amino acid sequence |
MHRTRTTPFSPTLIVTTLLSRDSPNSSKNPAMRRGITQRNSSSTSVEYNASYAYHSLFAYFDRD NVALKGFAKFFKESSDEERDHAEKLIKYQCGVQCIVRVPLPFRLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |