Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0106700_circ_g.3 |
ID in PlantcircBase | osa_circ_043341 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 306742-306966 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRI-long |
Parent gene | Os11g0106700 |
Parent gene annotation |
Similar to Ferritin 1, chloroplast precursor (EC 1.16.3.1) (ZmFe r1). (Os11t0106700-01);Similar to Ferritin 1, chloroplast precur sor (EC 1.16.3.1) (ZmFer1). (Os11t0106700-02) |
Parent gene strand | - |
Alternative splicing | Os11g0106700_circ_g.1 Os11g0106700_circ_g.2 Os11g0106700_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0106700-02:2 Os11t0106700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.200742593 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
306957-306918(-) |
Potential amino acid sequence |
MHRTRTTPFSPTLIVTTLLSRDSPNSSKNPAMRRGITQRNSSSTSVEYNASYAYHSLFAYFDRD NVALKGFAKFFKESSDEERDHAEKLIKYQCGVQCIVRVPLPFRLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | this study |