Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0967800_circ_g.3 |
| ID in PlantcircBase | osa_circ_005978 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 42687557-42687652 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE |
| Parent gene | Os01g0967800 |
| Parent gene annotation |
Conserved hypothetical protein. (Os01t0967800-01);Hypothetical c onserved gene. (Os01t0967800-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0967800_circ_g.4 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0967800-01:1 Os01t0967800-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1015625 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42687643-42687649(+) |
| Potential amino acid sequence |
MPTIGEEYAAEEPTKQLRLPPAFPRSLLLWPIMPTIGEEYAAEEPTKQLRLPPAFPRSLLLWPI MPTIGEEYAAEEPTKQLRLPPAFPRSLLLWPIMPT(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |