Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0606500_circ_g.3 |
ID in PlantcircBase | osa_circ_034692 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 24910313-24911571 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0606500 |
Parent gene annotation |
Hypothetical conserved gene. (Os07t0606500-01);Similar to ATP-de pendent RNA helicase, eIF-4A family. (Os07t0606500-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0606500-02:4 Os07t0606500-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017312 |
PMCS | 0.120478793 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24910350-24910316(+) |
Potential amino acid sequence |
MKNALHTDIDVNIYDGDTPREDRTWIRDNARLLITNPDMLHMSILPCHGQFQRILSNLRYIVID EAHSYKGAFGCHTALILRRLKRICSNIYGSHPTFIFCTATSANPREHVMELAKLDNVELIENDG SPCGFKYFLLWNPPLHMTKEGSSKDSLLTRRSRL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |