Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0606500_circ_g.3 |
| ID in PlantcircBase | osa_circ_034692 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 24910313-24911571 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0606500 |
| Parent gene annotation |
Hypothetical conserved gene. (Os07t0606500-01);Similar to ATP-de pendent RNA helicase, eIF-4A family. (Os07t0606500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0606500-02:4 Os07t0606500-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017312 |
| PMCS | 0.120478793 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24910350-24910316(+) |
| Potential amino acid sequence |
MKNALHTDIDVNIYDGDTPREDRTWIRDNARLLITNPDMLHMSILPCHGQFQRILSNLRYIVID EAHSYKGAFGCHTALILRRLKRICSNIYGSHPTFIFCTATSANPREHVMELAKLDNVELIENDG SPCGFKYFLLWNPPLHMTKEGSSKDSLLTRRSRL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |