Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0247800_circ_g.12 |
ID in PlantcircBase | osa_circ_030391 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 7666749-7667230 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0247800 |
Parent gene annotation |
Similar to Dynamin-like protein (Fragment). (Os06t0247800-01);No n-protein coding transcript. (Os06t0247800-02) |
Parent gene strand | + |
Alternative splicing | Os06g0247800_circ_g.11 Os06g0247800_circ_g.13 Os06g0247800_circ_g.14 Os06g0247800_circ_g.15 Os06g0247800_circ_g.16 Os06g0247800_circ_g.17 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0247800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.165803216 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7667185-7667162(+) |
Potential amino acid sequence |
MDGVGGGLSSMRKAERPPVPRQDLRKTQKTNQRKTKTKTNQASKTKTQKRGPLCRLLVLLVKLL QVTF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |