Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0419500_circ_g.4 |
| ID in PlantcircBase | osa_circ_033527 |
| Alias | Os07circ06566/Os_ciR3133 |
| Organism | Oryza sativa |
| Position | chr7: 13405962-13406160 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os07g0419500 |
| Parent gene annotation |
Similar to UDP-glucose:sterol glucosyltransferase. (Os07t0419500 -01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0419500_circ_g.1 Os07g0419500_circ_g.2 Os07g0419500_circ_g.3 Os07g0419500_circ_g.5 |
| Support reads | 4/4/1 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0419500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.470486935 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13406016-13405985(+) 13406126-13406123(-) 13406006-13406107(-) |
| Potential amino acid sequence |
MPWTPTCEFPHPFSRVKQPAGYRGMCMWLRL*(+) MREFTSRRPWHCENYVDWYLQSLSHMHMPLYPAGCFTREKG*(-) MWIGTFRASATCTCLYILQVVLHGRRDEGIHK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |