Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d012213_circ_g.2 |
ID in PlantcircBase | zma_circ_009794 |
Alias | zma_circ_0002906 |
Organism | Zea mays |
Position | chr8: 170163489-170164007 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d012213 |
Parent gene annotation |
wound-responsive family protein |
Parent gene strand | - |
Alternative splicing | Zm00001d012213_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d012213_T005:3 Zm00001d012213_T011:3 Zm00001d012213_T009:3 Zm00001d012213_T006:3 Zm00001d012213_T001:3 Zm00001d012213_T007:3 Zm00001d012213_T014:3 Zm00001d012213_T015:3 Zm00001d012213_T003:2 Zm00001d012213_T002:3 Zm00001d012213_T004:3 Zm00001d012213_T012:3 Zm00001d012213_T008:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.137150546 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
170163930-170163550(+) 170163660-170163953(-) 170163692-170163937(-) |
Potential amino acid sequence |
MLSRFWQITRGTDTRCRTSLEDRAQAPIQHHQRKNPQCHTDHHLVHH*(+) MGKHSSDEEDLNDVPDDDQYDTEDSFVDDAELVPVLYLPEMFYSEYQFLL*(-) MQSLKKLSAFTWENIAVTKRILMMYQMMISMTLRILSLMMLNWCLCSIFQRCSTASISSSCNLP KP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |