Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G61210_circ_g.1 |
ID in PlantcircBase | ath_circ_008270 |
Alias | At_ciR625 |
Organism | Arabidpsis thaliana |
Position | chr1: 22565102-22565445 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, circseq_cup, CIRI-full |
Parent gene | AT1G61210 |
Parent gene annotation |
Katanin p80 WD40 repeat-containing subunit B1 homolog |
Parent gene strand | + |
Alternative splicing | AT1G61210_circ_g.2 |
Support reads | 72 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G61210.2:2 AT1G61210.1:2 AT1G61210.3:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.186878391 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22565230-22565442(+) |
Potential amino acid sequence |
MSLCGHTSAVDSVAFDSAEVLVLAGASSGVIKLWDVEEAKKEFLAHSANVNCLSIGKKTSRLFI TGGDDYKVNLWAIGKPTSLMSLCGHTSAVDSVAFDSAEVLVLAGASSGVIKLWDVEEAKKEFLA HSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMSLCGHTSAVDSVAFDSAEVLVLAGA SSGVIKLWDVEEAKKEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMSLCGHT SAVDSVAFDSAEVLVLAGASSGVIKLWDVEEAK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |