Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G58750_circ_g.7 |
| ID in PlantcircBase | ath_circ_028188 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 21726123-21726381 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G58750 |
| Parent gene annotation |
Citrate synthase 2, peroxisomal |
| Parent gene strand | - |
| Alternative splicing | 3_circ_ag.2 3_circ_ag.3 3_circ_ag.4 3_circ_ag.5 AT3G58750_circ_g.1 AT3G58750_circ_g.2 AT3G58750_circ_g.3 AT3G58750_circ_g.4 AT3G58750_circ_g.5 AT3G58750_circ_g.6 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G58750.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.214029634 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21726367-21726125(-) |
| Potential amino acid sequence |
MPHDAHPMGVLVSAMSALSIFHPDANPALSGQDIYKSKQVRDKQIVRILGKDIIQSMPHDAHPM GVLVSAMSALSIFHPDANPALSGQDIYKSKQVRDKQIVRILGKDIIQSMPHDAHPMGVLVSAMS ALSIFHPDANPALSGQDIYKSKQVRDKQIVRILGKDIIQSMPHDAHPMGVLVSAMSALSIFHPD ANPALSGQDIYKSKQVRDKQIVRILGK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |