Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0394500_circ_g.1 |
| ID in PlantcircBase | osa_circ_023643 |
| Alias | Os_ciR9319 |
| Organism | Oryza sativa |
| Position | chr4: 19399087-19399617 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0394500 |
| Parent gene annotation |
Similar to H0718E12.6 protein. (Os04t0394500-00) |
| Parent gene strand | - |
| Alternative splicing | Os04g0394300_circ_igg.1 Os04g0394500_circ_g.2 Os04g0394500_circ_g.3 Os04g0394500_circ_igg.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0394500-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.490193404 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19399152-19399151(+) 19399533-19399557(-) |
| Potential amino acid sequence |
MKPSGRSLSLEPRTFGGLVPACISLELVLVGSASTPSPLSVSATESGCFGNGRDAGIWKKSNCA LSDRCISPSSSAVVNSPSWAPVAEDSPNSSSLRIYQRVNLRSSSSLYRSYIQVSSP*(+) MHRSDKAQLLFFQMPASLPLPKQPDSVAETDKGDGVDAEPTSTSSKEMHAGTRPPKVLGSKLKD LPEGFMGKILVYRSGKVKMKIGDSLFDKFLMKRSLESLLPPEPKMVN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |