Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G37500_circ_g.7 |
| ID in PlantcircBase | ath_circ_017081 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 15741598-15741805 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT2G37500 |
| Parent gene annotation |
Arginine biosynthesis bifunctional protein ArgJ, chloroplastic |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G37500.2:2 AT2G37500.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.165888422 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15741785-15741600(-) |
| Potential amino acid sequence |
MLDCVGSIATLLKVKPEEVLIESTGVIGQRIKKGDAGYQDMLDCVGSIATLLKVKPEEVLIEST GVIGQRIKKGDAGYQDMLDCVGSIATLLKVKPEEVLIESTGVIGQRIKKGDAGYQDMLDCVGSI ATLLKVKPEEVLIESTGVIGQRIKK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |