Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G65540_circ_g.3 |
| ID in PlantcircBase | ath_circ_008820 |
| Alias | Ath_circ_FC0891 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 24364786-24364932 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G65540 |
| Parent gene annotation |
LETM1-like protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G65540.1:1 AT1G65540.3:1 AT1G65540.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.471928284 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24364903-24364788(-) |
| Potential amino acid sequence |
MEYAKFLQDTVKEMAKEVQTSRSGEIKKTAEDLDGFMTKEALKRRLNARMEYAKFLQDTVKEMA KEVQTSRSGEIKKTAEDLDGFMTKEALKRRLNARMEYAKFLQDTVKEMAKEVQTSRSGEIKKTA EDLDGFMTKEALKRRLNARMEYAKFLQDTVKEMAKEVQTSRSGEIKKTAEDLDGFMTK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |