Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d037734_circ_g.2 |
ID in PlantcircBase | zma_circ_009059 |
Alias | zma_circ_0002329, GRMZM2G126435_C2 |
Organism | Zea mays |
Position | chr6: 135569441-135570636 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d037734 |
Parent gene annotation |
Serine/threonine-protein phosphatase 5 |
Parent gene strand | - |
Alternative splicing | Zm00001d037734_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d037734_T004:4 Zm00001d037734_T008:4 Zm00001d037734_T001:4 Zm00001d037734_T009:4 Zm00001d037734_T011:3 Zm00001d037734_T007:4 Zm00001d037734_T002:4 Zm00001d037734_T003:4 Zm00001d037734_T006:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.187893837 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
135570562-135569451(+) 135570564-135570628(-) |
Potential amino acid sequence |
MIVIVLQLYIKRIVSYEDLKDPYPQTMIW*(+) MDATANSDVQRAEEFKLKANDAFKANKFSQAIELYSQAIELNSSNAVYWANRAFAHTKLEEYGS AVQDATKAIEIDSRYSKGYYRRGAAYLAMGKFKEALKDFQQVKKICPNDPDATRKLKECEKAVQ KIRFEEAISAGDDERRSVADSIDYHIIVCG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |