Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d037734_circ_g.2 |
| ID in PlantcircBase | zma_circ_009059 |
| Alias | zma_circ_0002329, GRMZM2G126435_C2 |
| Organism | Zea mays |
| Position | chr6: 135569441-135570636 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d037734 |
| Parent gene annotation |
Serine/threonine-protein phosphatase 5 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d037734_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d037734_T004:4 Zm00001d037734_T008:4 Zm00001d037734_T001:4 Zm00001d037734_T009:4 Zm00001d037734_T011:3 Zm00001d037734_T007:4 Zm00001d037734_T002:4 Zm00001d037734_T003:4 Zm00001d037734_T006:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.187893837 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
135570562-135569451(+) 135570564-135570628(-) |
| Potential amino acid sequence |
MIVIVLQLYIKRIVSYEDLKDPYPQTMIW*(+) MDATANSDVQRAEEFKLKANDAFKANKFSQAIELYSQAIELNSSNAVYWANRAFAHTKLEEYGS AVQDATKAIEIDSRYSKGYYRRGAAYLAMGKFKEALKDFQQVKKICPNDPDATRKLKECEKAVQ KIRFEEAISAGDDERRSVADSIDYHIIVCG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |