Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0137000_circ_g.1 |
| ID in PlantcircBase | osa_circ_008393 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 1702965-1703835 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0137000 |
| Parent gene annotation |
Similar to PIN1-like auxin transport protein. (Os11t0137000-01) |
| Parent gene strand | - |
| Alternative splicing | Os11g0137000_circ_g.2 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0137050-00:3 Os11t0137000-01:4 Os11t0137050-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009029 |
| PMCS | 0.218059979 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1703718-1703822(-) |
| Potential amino acid sequence |
MAAAMPPASVMTRLILIMVWRKLIRNPNTYSSLLGVIWSLVSYRWGIEMPAIIARSISILSDAG LGMAMFSLGLFMALQPRIIACGNSLASYAMAVRFLVGPAVMAAASIAVGLRGVLLHIAIVQAAL PQGIVPFVFAKEYNVHPNILSTASSGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |