Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA040597_circ_g.1 |
| ID in PlantcircBase | osi_circ_008306 |
| Alias | CH398337.1:12459|13253 |
| Organism | Oryza sativa ssp. indica |
| Position | chrCH398337.1: 12459-13253 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA040597 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA040597_circ_g.2 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA040597-TA:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_006438* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12558-12809(-) 12556-12490(+) |
| Potential amino acid sequence |
MSTFSTISCGSSGFSSAASFFSACSSFTDSFSSFCPAYTLLQNLRTSVAVHLDLQDDSYCLRWL LFLFFWRWCWSFLFLLLFWRWRKRENQLDSSLCLPLNPLADL*(-) MHCEGCAKKVEKSLLRFEGVENVKADSRSKTVVVKSRAADPSKVCERVQRKTKRRVELIFPLPP PPEEEKKEEAPAPPPEEKKEEPPKTITVILKVQMHCDACAQILQKRISRTEGTKGVCERRAG*( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |