Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0421700_circ_g.1 |
| ID in PlantcircBase | osa_circ_023812 |
| Alias | Os_ciR4802 |
| Organism | Oryza sativa |
| Position | chr4: 20847994-20848209 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0421700 |
| Parent gene annotation |
FAR1 domain containing protein. (Os04t0421700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0421700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.311049383 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20848190-20847996(-) |
| Potential amino acid sequence |
MGPISYDEMPSGLDPTFTTHLGFATYHTSQVSSSSPHNQGIDLSSPMGPISYDEMPSGLDPTFT THLGFATYHTSQVSSSSPHNQGIDLSSPMGPISYDEMPSGLDPTFTTHLGFATYHTSQVSSSSP HNQGIDLSSPMGPISYDEMPSGLDPTFTTHLGFATYHTSQVSSSSPHNQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |