Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0275550_circ_g.1 |
| ID in PlantcircBase | osa_circ_030538 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 9355450-9355611 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0275550 |
| Parent gene annotation |
Hypothetical protein. (Os06t0275550-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0275500-01:1 Os06t0275550-00:1 Os06t0275500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.460555298 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9355461-9355608(+) |
| Potential amino acid sequence |
MQEDQSVLGRRRIYYDTNCGEALICSDSEDEAVEDEEEKKEFKDSEDCIIRNQRMQEDQSVLGR RRIYYDTNCGEALICSDSEDEAVEDEEEKKEFKDSEDCIIRNQRMQEDQSVLGRRRIYYDTNCG EALICSDSEDEAVEDEEEKKEFKDSEDCIIRNQRMQEDQSVLGRRRIYYDTNCGEALICSDSED EAVEDEEEKKEFKDSEDCII(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |