Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0573000_circ_g.8 |
ID in PlantcircBase | osa_circ_009662 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 21510492-21511252 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0573000 |
Parent gene annotation |
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family pr otein. (Os11t0573000-01);Similar to Ubiquitin carboxyl-terminal hydrolase family protein, expressed. (Os11t0573000-02) |
Parent gene strand | - |
Alternative splicing | Os11g0573000_circ_igg.1 Os11g0573000_circ_g.2 Os11g0573000_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0573000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.14623329 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21510540-21510494(+) 21511157-21511250(-) 21510496-21510493(-) |
Potential amino acid sequence |
MYSSTMNKNTVKSIKVSYTSICIWSKIFSIISIQIKLQREFIAVINH*(+) MLFTVFLFIVEEYMAVTTMPSFDQRYQIND*(-) MINDRYEFPLQLDLDRDDGKYLAPDADRSIRNLYALHSVLVHSGGVHGGHYYAFIRPTLSDQ*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |