Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0573000_circ_g.8 |
| ID in PlantcircBase | osa_circ_009662 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 21510492-21511252 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0573000 |
| Parent gene annotation |
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family pr otein. (Os11t0573000-01);Similar to Ubiquitin carboxyl-terminal hydrolase family protein, expressed. (Os11t0573000-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0573000_circ_igg.1 Os11g0573000_circ_g.2 Os11g0573000_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0573000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.14623329 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21510540-21510494(+) 21511157-21511250(-) 21510496-21510493(-) |
| Potential amino acid sequence |
MYSSTMNKNTVKSIKVSYTSICIWSKIFSIISIQIKLQREFIAVINH*(+) MLFTVFLFIVEEYMAVTTMPSFDQRYQIND*(-) MINDRYEFPLQLDLDRDDGKYLAPDADRSIRNLYALHSVLVHSGGVHGGHYYAFIRPTLSDQ*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |